PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g23190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 346aa    MW: 37858 Da    PI: 5.4739
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g23190genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18258292135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Tp7g23190 258 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 292
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.7E-10026346IPR016679Transcription factor, GATA, plant
SuperFamilySSF577163.85E-14251314No hitNo description
PROSITE profilePS5011411.648252288IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-16252306IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.3E-15256290IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.65E-14257305No hitNo description
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
PfamPF003201.4E-16258292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MALVEAGLKS FIRKDMALKM TPPVCEDSLA VTTAQNDFSS EDFSVDDLLD LSNDDDLLGL  60
SNGDVFADEE ETQQEMLRVS SEEPNDNGDA LRRSDDFSSR DGFGSLPSNQ LSVPVDELAD  120
LEWLSHFVED SFTEYSAPSL TGNPTEKPAW LTGDRKHPAT PTTEESCFKS PLPAKARSRR  180
NRNGVKVWSL GSSGPSSSSS TSSSSSSSGL SSPWFSGAEL LEPDFTSEKP PALKKHKKKS  240
SESVFNGKLL QQPPLRRCSH CGVQKTPQWR AGPMGAKTLC NACGVRYKSG RLLPEYRPAC  300
SPTFSSELHS NHHRKVIEMR RKKEPTDDNS TGLNQPVQSP QAVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201433.11e-170GATA transcription factor 5
RefseqNP_975002.11e-170GATA transcription factor 5
SwissprotQ9FH571e-171GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0D3A6701e-162A0A0D3A670_BRAOL; Uncharacterized protein
TrEMBLD7MMY81e-162D7MMY8_ARALL; Zinc finger family protein
STRINGAT5G66320.11e-169(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-142GATA transcription factor 5